PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G351500.2
Common NameB456_007G351500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 271aa    MW: 29456.4 Da    PI: 9.3104
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G351500.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like971.4e-3085138155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Gorai.007G351500.2  85 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 138
                         59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.33E-2082142IPR009057Homeodomain-like
PROSITE profilePS5129411.05982141IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.6E-3184143IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-2486138IPR006447Myb domain, plants
PfamPF002499.7E-888137IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MREIEDSSNL FGKWEEELPS PEELMPLSQT LITPHLALAF DISNPNHRQR KHPPPPPPPP  60
AEFAGDSGDL GSGAGGDEPA RTLKRPRLVW TPQLHKRFVD AVAHLGIKNA VPKTIMQLMS  120
VDGLTRENVA SHLQKYRLYL KRMQGSGGGG ANGGAASDPA TDHLFASSPV PPHFLHPSKG  180
SSEPFAPFVS VPGLQHHHYQ QQQHQLAAAA AVGHPHLLTQ YQKQIGHFGS SPNGQLEHPF  240
LAKQPPPSIR RMGGSLMHGY LGNQLMFTYI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-2184143463ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012434867.11e-141PREDICTED: transcription factor PCL1-like isoform X2
SwissprotQ9LTH42e-44PCLL_ARATH; Transcription factor BOA
TrEMBLA0A0D2TRT70.0A0A0D2TRT7_G
STRINGPGSC0003DMT4000722131e-100(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.13e-60G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]